PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c4_7100V3.2.p
Common NamePHYPADRAFT_167323
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family MYB
Protein Properties Length: 2608aa    MW: 279494 Da    PI: 5.9187
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c4_7100V3.2.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding322.8e-1012041247347
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding    3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47  
                         WT  E el+ +av ++G++ +++Ia+++g ++++ qcks++ k 
  Pp3c4_7100V3.2.p 1204 QWTDKERELFTEAVSLFGKD-FESIAAHVGSTKSEGQCKSFFSKT 1247
                        5*****************99.*********99*********9886 PP

2Myb_DNA-binding31.63.7e-1016781719346
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding    3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46  
                        +WT+eE e ++d ++ +G++ W++  ++++ +++l q+k ++q+
  Pp3c4_7100V3.2.p 1678 SWTQEEKEVFADIIRNYGKD-WTRLHECLP-TKSLTQIKTYFQN 1719
                        7*****************99.*********.************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.94E-139501013IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.0E-49571006IPR009057Homeodomain-like
PROSITE profilePS5129317.6879621013IPR017884SANT domain
SMARTSM007175.8E-89631011IPR001005SANT/Myb domain
PROSITE profilePS5129317.55512001252IPR017884SANT domain
SMARTSM007176.2E-912011250IPR001005SANT/Myb domain
PfamPF002496.3E-912041246IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-512041249IPR009057Homeodomain-like
SuperFamilySSF466899.72E-1012041255IPR009057Homeodomain-like
CDDcd001676.08E-612051244No hitNo description
Gene3DG3DSA:1.10.10.607.1E-716711720IPR009057Homeodomain-like
SuperFamilySSF466897.59E-1116711723IPR009057Homeodomain-like
PROSITE profilePS512938.33516741725IPR017884SANT domain
SMARTSM007173.6E-816751723IPR001005SANT/Myb domain
PfamPF002491.8E-716781719IPR001005SANT/Myb domain
CDDcd001677.54E-616781721No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000006anatomyplant protoplast
PO:0025017anatomyplant spore
PO:0030003anatomyprotonema
PO:0030018anatomygametophore
Sequence ? help Back to Top
Protein Sequence    Length: 2608 aa     Download sequence    Send to blast
MYSPGRGDAR ATAPPNARDS STSMPIDHSS AWQREPYNRD VRLDRGDRDR TIGGKREWSS  60
DRASPGAPYQ RGFGGLHSVN GNLGPPNKRR LNGRHSGFHT ENRRYGSAGY RGEPPFGSIV  120
PLDNGLARKL DRDSFYPGSG CLVTNTGFSN GPGIDHRSKE LEEKLKLGSF LSSGNGRDGG  180
ASGGHDQNGR PFPSQVLTEV ENTSWERERS KGLVGNGWES SQRSEREHRE RLLGKAESYS  240
RREGKFSQFE GGKDSSQVDQ DLELRKLDRC GSSSWDSFSG DTVCESKLSV HGLDWRRKER  300
STSDCLSRSA SYVASNGGTK ESMVRSQGLD VSGRASSPHR SPKSKPPSAR VEVSRDDGNH  360
PSPPKRPRLG WGQGLAKYEK KKVVETDENV VSGSVGSVSG GGRSSITSVI SGPTTEVVQT  420
QDLQMAEDST VSVVSKLAPS PSLTPSVSLL PQTLESVSKP CLESPGVTRE DLNKSYVKAA  480
NGIDLPTLTA TSPGSRVEDS VTNADLFAAT ECSLELSVRQ SDSCEPVERP TALKESSSCR  540
ASPAAPCSVE QCCGLEVTQE VCSTGDTTWW SKEDILQRVE KLESEIEQVE RELATLEQFR  600
SLKNDAPTPV PETFEDSADK DTGTELEPGK NGHHVMGQDA VVLHAGSMEC RDDSQPLLAS  660
SPNRICSVSP ECISHSVSSL ETGAAVGAGP PMCNQEGQSH EGEKEATSDQ TMVESEGEGS  720
LVSSPSAEVY LPHMTHRERA GVKVRMSKSA IAEKESSDAA MVVGDVEAVA RGLIGENKDQ  780
ARHASEAFLH LLSQGGRGEG KVYSCPVEAP VWKENVERHV RNQEKMLEKI AERRQSARFV  840
EQVLTIKFRA LKDAWRQEQF GTSQQQRGTK PVRRWEAEKR GGTAGCHRSS LRLRPVQAGG  900
GKLEAQSEES MKRVMVEPVV GPLRPALKMP AMILGERERL ARRFESNNAL VEDPVRVESE  960
RKSINPWSAE ERRVFLEKFA VYNKNFSKIA SHLEYKTTAD CVEFYYRNQK SEDFEKIRRR  1020
QQLKKRRDYS RLGGSFLSTG LQPNSRQREA NIDARSEGWN MQTSGAVSTV CQITVGAKAA  1080
RSSTHHKPLE RQRTSSSLDP GSLPAVVEIA KSTSGKESRP SGIPPLPSGA AGSGTTGSCS  1140
LSSATAASVK VSRERTSVKS NWNGGSAVAR SGTKEQQMSG PKGARSVNIR RGLTTSAGEE  1200
ANAQWTDKER ELFTEAVSLF GKDFESIAAH VGSTKSEGQC KSFFSKTRKR LRLDQLVEKY  1260
QAALNFRADA AVAESPEFID VQMEEVPGAA AEVVLVASLE ANIYPSLGEE KVWNEATESG  1320
KVEEVANDVS VQATEAVEAE MCKDIAAEKT VEEESYEDVV VAKAVEEGLC EGVAIERAGK  1380
EEIFDNAAVH KAVEEVLSED VGVEKAVEDR SVEAKGVEVE CTPGKGVEHQ AVKDEVVDDE  1440
TVEDVAEEGV VGVIEVVETV DFVGVSMDLT VESAVCPPES PDIVEDVKKA EADVGAGACS  1500
MNECDTGEAE DVFAACIKAE PVVVDEEVVS EPLTVDAGEE LPAGNSSGSS ADCGMQEEGD  1560
AVEVAKGAES VVESVKREVD AGDDKGLGTV VATSTLAAEE QLVEASGAVD VKHEAGSPQV  1620
AVSTGTESGS CAIGAEGACH SGKAAYATTS SMHGSQQCRE KSGRVGSGEA KPRREPTSWT  1680
QEEKEVFADI IRNYGKDWTR LHECLPTKSL TQIKTYFQNS KAKLGLVNSE GVSVGGGRGS  1740
GSRKRKAEEV DNMSNNVGCV SGGNESKCGS VSGGDVDGGG QKVKGGMGDP PSMSVSAGMG  1800
TIPVGLEGLA YPFFGQRAED QMALHQFMRQ LQLCNPNGLP QNIPPMLYPL LQQQGLGVFP  1860
YPGLQRAGPP NLQQQFAASM SQKTSQSMGL QLALQGPGVG QQSGAVDLHQ QGAHQLQNSQ  1920
AARSQQQLLA NMMQQAAAQQ AAAQLQQQQY QYSKSVVHPQ QQVMVLQPGQ VSQRQQQLVS  1980
QQVGHHPQVQ QVCQAQESSS VHPVGSESLG VNHPDQLTFH LKQLHEQQQQ QAYIQQPQFQ  2040
RAVHLVQKQQ QQQHSQHDLA ESNSQGHIHQ HHSCHTSPVP SVAVPKPKGL MISPQQPTAT  2100
FSAPLLQQGG SIHRQDQQPQ HGVSMTLFSG NGGSSLSGNV GDVSNYHGEL GELRENCSDE  2160
GAAKAREFSR ADLHQMSAAV QRVKPLQAAV PPVPSSTPAT ESPQSRPVDV KLFGQSLLSQ  2220
PTCSGALQSA ARASLPTADK VSLRESAVYT TSSSPVTSMS VPAATGSKAY AKEASFSGVP  2280
AMPDGRQGGW PSTGYSVITE ARKNVNGMRP QVGPVWKSKE GELELHNIQE GRMSRGARRA  2340
EPEQNVPTIT HKLYDHEQSR SDLMHSRSEA HLSVNNFGDS ANEQGGGFPS SSGEGLGADY  2400
ERKSESTVLD SDGCERGSTM CSRGSRALAD SFAMQTIGSL ANGSQISRTV MNALVAFADL  2460
QSRNLQSFSS TGSPRLEDHQ WESLVRQAAH GAAVESLKAH PSVGRGGPSG APQAHLSGGD  2520
LLQQCVRDGG MYFTQHYPRL ASQPGVSSGA WNAGAGLMNP SDVQRVLVSP AFSSFLPGAL  2580
SRAPPAAEEH LGSTKSRDPD NGGGGLR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_C9e-169211015194NUCLEAR RECEPTOR COREPRESSOR 2
4a69_D9e-169211015194NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.129650.0protonema
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001771897.10.0predicted protein
TrEMBLA9SZT20.0A9SZT2_PHYPA; Predicted protein
STRINGPP1S143_55V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.17e-35MYB family protein
Publications ? help Back to Top
  1. Rensing SA, et al.
    The Physcomitrella genome reveals evolutionary insights into the conquest of land by plants.
    Science, 2008. 319(5859): p. 64-9
    [PMID:18079367]